PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0682s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 293aa    MW: 33021.8 Da    PI: 9.2337
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0682s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.22.3e-1620107195
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          ffkv      ++s+ l +p  f++ +  +   +    l+d +gr W+v l  ++ +++ ++++GW+ Fv +  L eg+f++F++d+ ++f
  Kalax.0682s0010.1.p  20 FFKVY--LARFSSHHLKIPPAFVKYCVRN--LPERALLKDVNGRAWDVGL--DRADDGLFIEDGWETFVGDAVLSEGEFLIFTYDQ-DDF 102
                          66776..77889999********666433..455699*************..********************************98.888 PP

                          ..EEE CS
                   B3  91 elvvk 95 
                          ++vvk
  Kalax.0682s0010.1.p 103 TFVVK 107
                          88886 PP

2B336.11.2e-11199272985
                          HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                           +++++ l l  k +++h+++   + t++l+     +W+ k+ ++ k+gr +l++GW +F +an+Lk+gD + F+++
  Kalax.0682s0010.1.p 199 AMSNKHKLNLDGKLLKKHNIQM--HPTVKLYIGGLSKWTTKF-VTSKDGRLYLGSGWTHFYHANDLKAGDECDFEFV 272
                          4566677999999999997773..33899999999*******.6888899************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.04E-1917114IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-1717109IPR015300DNA-binding pseudobarrel domain
CDDcd100171.54E-1318107No hitNo description
PROSITE profilePS5086311.88518112IPR003340B3 DNA binding domain
PfamPF023623.8E-1420107IPR003340B3 DNA binding domain
SMARTSM010191.8E-1120111IPR003340B3 DNA binding domain
PROSITE profilePS508639.925191292IPR003340B3 DNA binding domain
SuperFamilySSF1019363.73E-12191272IPR015300DNA-binding pseudobarrel domain
CDDcd100179.92E-8193272No hitNo description
Gene3DG3DSA:2.40.330.101.6E-12193277IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.089194285IPR003340B3 DNA binding domain
PfamPF023622.0E-9197273IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTRQQTRPSH SAAGDVPPEF FKVYLARFSS HHLKIPPAFV KYCVRNLPER ALLKDVNGRA  60
WDVGLDRADD GLFIEDGWET FVGDAVLSEG EFLIFTYDQD DFTFVVKRYG IHGCRKDVCL  120
ASNKEIVCVN LKDVEENVGD HELAPCTDGS GGSIRNLRPL KSRLRISGNK AVAAKGDLAW  180
SEASGRIVSN CLHLSKTMAM SNKHKLNLDG KLLKKHNIQM HPTVKLYIGG LSKWTTKFVT  240
SKDGRLYLGS GWTHFYHAND LKAGDECDFE FVLENRMRAR RCKQIRVQIR HI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.17e-24B3 family protein